Related Searches : Trypsin-Chymotrypsin MixSyringesIrrigation Syringesyringe highlightermedical syringessyringe tubedispensing syringe
Need Help?Contact Us
Biopro Chemicals Co., Ltd.
roll forming machines
Wuxi Wondery Trading Co.,Ltd.
Common Rail Deisel
High purity Testosterone Enanthate Nandrolone Decanoate

  • Trypsin syringe

    Injection amp; Puncture Instrument 1ml Jiangsu China (Mainland) 

    Trypsin syringe,blister packaging,needle attached,100U,40U, march 29G, 30G needle Trypsin syringe,blister packaging,needle attached,100U,40U, march 29G, 30G needleDescription:1ml, blister packagingLength:0.62Width:0.36Height:0.33pcs/box:2000

  • Supplier - Yixing Kairun Imp & Exp Co., Ltd.
    [Manufacturer, Trading Company]
    China (Mainland)
  • trypsin

    trypsin product Name: trypsin Synonyms: Trypsin from bovine pancreas; trypsin from hog pancreas; trypsin type ix from porcine pancreas; trypsin type xi dpcc treated from*bovine pancreas; trypsin tpck treated from*bovine pancreas; trypsin type xii-S f

  • Supplier - Wuhan Yuancheng Gongchuang Technology Co.,Ltd
    China (Mainland)
  • Trypsin

    Beijing China (Mainland) Any port of China high purity protease Food Grade, Medicine Grade, Oth... crystalline powder 232-650-8 L/C,D/A,D/P,T/T 

    1.USP /EP standard Trypsin 2.Trypsin in high quality and best price grade trypsin Trypsin Source: Porcine (Bovine) pancreasGeneral descriptionTrypsin is a kind of serine proteolytic enzyme

  • Supplier - Beijing Geyuantianrun Bio-Tech Co., Ltd.
    [Manufacturer ]
    China (Mainland)
  • Trypsin

    Shanghai China (Mainland) Shanghai 99% Trypsin high T/T,Western Union,MoneyGram Seebio 2 Metric Ton/Metric Tons per Year 

    Trypsin is a proteolytic enzyme Trypsin is a proteolytic enzyme, which specifically cleaves positively charged side chains with lysine and arginine. The optimum pH is 8.0. Trypsin is inhibited by natural inhibitors from pancreas

  • Supplier - Seebio Biotech Inc.
  • Trypsin

    CP,EP,BP,JP,USP 50T/Year largest producer of enzymes in china 

    Trypsin Resource: Porcine or bovine pancreas General introduction: Trypsin is a proteolytic enzyme. It can hydrolyze the positive charge side linking that containing lysine and arginine. The best effective condition is PH 8.0. It can be restrained

  • Supplier - Sichuan Deebio Pharmaceutical Co., Ltd.
    China (Mainland)
  • Trypsin

    Shandong China (Mainland) china port 2500u/mg fraken Food Grade, Medicine Grade Trypsin L/C,T/T 1 Kilogram/Kilograms or as your need 

    Trypsin assay: 2500u/mg min standard:cp2005,EP5.0,usp28,BP2002 Trypsinassay: 2500u/mg minstandard:cp2005,EP5.0,usp28,BP2002application: cure part dropsy, haematoma, abscess and other diseases which caused by pus-chest, henothorax

  • Supplier - Qingdao Fraken International Trading Co., Ltd.
    China (Mainland)
  • recombinant trypsin

    Zhejiang China (Mainland) cell culture, Insulin Shanghai gt;95% by SDS-PAGE trypsin L/C,T/T INDUMY Catalyst 

    r-Trypsin expressed in E. Coli is purified by chromatography to homogeneity of high purity. Its molecular weight is 24 kda, Recombinan Trypsin ( r-Trypsin) expressed in E. Coli is purified by chromatography to homogeneity of high purity. Its mol

  • Supplier - Zhuji Wanshun Socks Co., Ltd.
    [Manufacturer ]
    China (Mainland)
  • Bovin Trypsin

    Bovin TrypsinSynonymCationic trypsinBovine pancreatic trypsinBeta-trypsinAlpha-trypsinSource: Highly purified bovin trypsin from bovin Pancreas.CAS Number: 9002-07-7UniProt ID: P00760EC: IVGGYTCGANTVPYQVSLNSGYHFCGGSLINSQWVVSAAHCYKSGIQVRL

    China (Mainland)
  • Trypsin (USP)

    Hebei China (Mainland) C6H15O12P3 china Trypsin (porcine pancreas) Medicine Grade 232-650-8 L/C,D/P,T/T,Western Union BDSC 

    1. Resource: Porcine or bovine panceas 2. Form:White or whitish crystal powder 2. High purity 3. Copetitive price Test ItemsSpecificationResultAppearancewhite powderConformsIdentificationConformsConformsTrypsin≤2500USP.U/mg3372USP

  • Supplier - Baoding Sino-Chem Industry Co., Ltd.
    [Manufacturer,Trading Company]
    China (Mainland)
  • Trypsin (Bovine Pancreas)

    Hebei China (Mainland) C6H15O12P3 Xingang, Qingdao N.L.T. 2,500 USP units / mg powder trypsinogen Medicine Grade L/C,T/T LD 

    Trypsin Source: Bovine Pancreas EC: CAS:9002-07-7 TrypsinSource: Bovine PancreasEC: is a proteolytic enzyme, which specifically cleaves positively charged side chains with lysine and arginine

  • Supplier - Hebei Lead Bio-Chemicals Co., Ltd.
    China (Mainland)
  • Recombinant Porcine Trypsin

    High Purity Reagents 9002-07-7 

    Recombinant Porcine Trypsin 1 Animal Origin Free, No Virus Contaminant DESCRIPTION Trypsin is a member of the serine protease family. Trypsin cleaves peptides on the C-terminal end of lysine and arginine amino acid residues. The pH optimum of trypsi

  • Supplier - Shanghai Yaxin Biotechnology Co., Ltd.
    China (Mainland)
  • Trypsin-Chymotrypsin

    General Reagents Sichuan China (Mainland) 200 Ton/Tons per Year L/C,T/T 

    Trypsin-Chymotrypsin is a Proteolytic enzyme Trypsin-Chymotrypsin is a Proteolytic enzyme. It can liquefy pus and ruined organization depurate wounds; it also can accelerate the recovering of injuries. Specification:6:1 9:1

  • Supplier - Deyang Sinozyme Pharmaceutical Co., Ltd.
    China (Mainland)
  • trypsin

    China (Mainland) C6H15O12P3 232-650-8 98 T/T,Western Union JYL 600 Metric Ton/Metric Tons per Year High Purity Reagents 

    Trypsin is a Proteolytic enzyme. It can hydrolyze the positive charge side linking that containing lysin and arginine. General Introduction:Trypsin is a Proteolytic enzyme

  • Supplier - Shenyang Jin Yi Lai Chemical Co., Ltd.
    China (Mainland)
  • Trypsin

    China (Mainland) C6H15O12P3 FOB TIANJIN/DALIAN 2500u/mg Trypsin L/C,T/T 1000 Metric Ton/Metric Tons per Month Pharmaceutical Intermediates 

    1. Standard:USP,BP,EP 2.Trypsin: NLT 2500USP units/mg powder 3.Source: Porcine (Bovine) pancreas 4.High purity in low pric Trypsin is a kind of serine proteolytic enzyme, with molecular weight of 23300 dalton

    China (Mainland)
  • Trypsin

    L/C,T/T CFR From Mar 26,2012 To Mar 26,2013 

    Wanbang BioPharmaceuticals has been established in 1981, is a leading anti-diabetic pharmaceutical company in China. We can manufacture the trypsin in the existing plant. Welcome to inquire.

  • Supplier - Wanbang Biopharmaceuticals
    [Manufacturer, Trading Company]
    China (Mainland)
  • Syringe

    medic transparement SHANGHAI none Shanghai China (Mainland) L/C,D/A,D/P,T/T,Western Union,MoneyGram Injection amp; Puncture Instrument 2000000 Piece/Pieces per Month 

    1,Socket type without needle (with needle) syringe 2Without screw-type needle (with needle) syringe 3. Insulin syringe. 1.Style:socket type without needle /with needle syringe Without screw-type needle/with needle syring Insulin syringe2.Size

  • Supplier - Shanghai Medic Industry Co., Ltd.
    [Manufacturer,Trading Company]
    China (Mainland)
  • Syringes

    Joyjun or OEM Shanghai Auto Disable Shandong China (Mainland) L/C,T/T,Western Union,MoneyGram Injection amp; Puncture Instrument 3ml, 5ml,10ml 10000000 Piece/Pieces per Month 

    Syringes Safery Huber, which avoid norses' hand being pricked; Be destroyed after single use; SyringesEasy and simple operation, which is almost the same as traditional syringes;Safery Huber, which avoid norses' hand being pricked

  • Supplier - Qingdao Joyjun Medical Products Co., Ltd.
    [Manufacturer,Trading Company]
    China (Mainland)
  • Syringes

    OEM qingdao 1cc to 50cc Shandong, China (Mainland) L/C,T/T,D/P Injection Puncture Instrument CE and ISO 5000000 Piece/Pieces per Day 

    Syringe with luer lock or luer slip. The nozzle is in centre or sider. 2-parts syringe from 2cc to 20cc. Syringe with luer lock or luer slip. The nozzle is in centre or sider.2-parts syringe from 2cc to 20cc.3-parts syringe from 1cc to 60cc

  • Supplier - Shanchuan Medical Instrument Co., Ltd
    China (Mainland)
  • Syringes

    OEM qingdao 1cc to 50cc Shandong, China (Mainland) L/C,T/T,D/P Injection Puncture Instrument CE and ISO 5000000 Piece/Pieces per Day 

    Syringe with luer lock or luer slip. The nozzle is in centre or sider. 2-parts syringe from 2cc to 20cc. Syringe with luer lock or luer slip. The nozzle is in centre or sider.2-parts syringe from 2cc to 20cc.3-parts syringe from 1cc to 60cc

  • Supplier - Shandong Zibo Shanchuan Medical Instrument Co., Ltd
    China (Mainland)
  • Syringe

    qingdao guangzhou or shanghai Medical Polymer Materials Product... Pipe,Drainage Tubes Containers China (Mainland) large quantity per month L/C,T/T,Western Union 

    1.Syringe2.We can offer you kinds of catheters, syringes, infusion sets, and blood pressure sets. 1.Syringe2.We can offer you kinds of catheters, syringes, infusion sets, and blood pressuresets.3.packing:as customer's requirements

  • Supplier - Shandong Mingyuan Imp. & Exp. Co., Ltd.
    [Buying office]
    China (Mainland)
  • Syringe

    Injection amp; Puncture Instrument Surgical Supplies 

    Syringe - disposable syringes, needles, appliances for blood transfusion, appliances for transfusion of infusion liquids, colostomy, ileostomy, urostomy and colo-ileostomy bags, containers for preservation and preperation of blood

  • Supplier - Unimex Holding Ltd.
    [Trading Company]
  • Syringe

    Shanghai Injection Puncture Instrument 16G to 30G China (Mainland) L/C,T/T 

    Syringe Specification: Capacity: 1ml,3ml,5ml,10ml,20ml,30ml,50ml,60ml,100ml Blister packing and polybag packing....... SyringeDescription:disposable syringe,irrigation syringe, syringe for insulin(1)Capacity: 1ml, 3ml, 5ml, 10ml, 20ml, 30ml, 50ml

  • Supplier - SIP Texnet I&E (Medical) Co., Ltd
    China (Mainland)
  • syringes

    Jiangsu China (Mainland) shanghai 1ml leun 1000000 Piece/Pieces per Day L/C,D/A,D/P,T/T 

    our company was built in 1988,our products have high quality. syringes, 1mldetails:three partsluer slipwith needles or without needlethe latex piston or the latex free pistonthe PE or Blister individual packagethe PE or Box secondly package

  • Supplier - Changzhou Medical Appliances General Factory Co., Ltd.
    China (Mainland)
  • Syringe

    Zhejiang China (Mainland) Shanghai Injection amp; Puncture Instrument KS Series KANGSHI 1,200,000 Piece/Pieces per Day L/C,D/A,D/P,T/T,Western Union,MoneyGram 

    1.Syringe 2.With or Without Needle 3.CE, ISO 13485 4.Sterilized EO, non-toxic, non-pyrogenic, single use Disposable syringe for hypodermic, intramuscular and intravenous injection.1.Sterilized EO, non-toxic, non-pyrogenic, single use only.2

  • Supplier - Zhejiang Kangshi Medical Devices Co., Ltd.
    China (Mainland)
  • Syringe

    Injection Puncture Instrument SY-1002 Medical Absorbable Suture China 

    Metal syringe----10ml / 20ml / 50ml / 100ml PVC syringe-----10ml / 20ml / 50ml / 100ml Suture need Metal syringe----10ml / 20ml / 50ml / 100ml PVC syringe-----10ml / 20ml / 50ml / 100ml Suture needle---10 pcs / bag Surgical scissors--14# /

  • Supplier - Apolex Healthy Co.,Ltd
    Russian Federation
  • Syringes

    China by sea, by air 

    Syringes: 1) Types: Three-parts syringe or two-parts syringe 2) Sizes available: 1ml, 2.5ml, 3ml, 5ml, 10ml, 20ml, 30ml, 50ml, 60ml, 100ml 3) Material: Medical grade PP 4) Transparent barrel and plunge 5) Centric/Eccentric nozzle, luer lock/slip

  • Supplier - Wzcare Medical Co., Ltd.
    [Manufacturer, Trading Company]
    China (Mainland)
  • Syringe

    Injection amp; Puncture Instrument Chongqing, China (Mainland) 

    Material: transparent or high transparent Key Specifications/Special Features:2 part syringe without piston Sterile Slip center or off-center with needle OEM orders are welcome Packing: poly or blister bagPayment Details:Payment Terms

  • Supplier - Chongqing Fuyuan Chemical Co., Ltd.
    China (Mainland)
  • syringe

    Jifeng Ningbo or Shanghai veterinary syringes WJ112 Zhejiang China (Mainland) T/T,Western Union Injection Puncture Instrument china 

    syringe passed ISO9001:2008 ,"Famous Brand Product in China Int'l Agricultural Exposition of 1999" syringe1ml B Type Continuous SyringeIt is mainly used for small animal disease prevention and treatment by vet

  • Supplier - Shaoxing County Wanjia Appliance Co., Ltd.
    China (Mainland)
  • Syringe

    Syringe Pump HK-500IA 1.All standard syringes of 10ml, 20ml, 50ml are compatible. 2.Unique function of bedside injection supervision. 3.Excellent injection function and operation. 4.Double CPU system More details More info ...

    [Manufacturer,rading Company]
    China (Mainland)
  • Syringe

    OEM high quality shanghai LS0011 T/T,Western Union The Basis of Surgical Instruments China 100,000 Piece/Pieces per Day free sample 

    Syringe 1.The first got the ISO,CE& FDA approval 2.Excellent quality(pvc) 3.Reasonable price 4.Specialfication:1ml--60ml Shaanxi Longstar I/E Co.,Ltd.disposable syringe1. Sterilized by EO gas, non-toxic, non-pyrogenic, single use only.2

  • Supplier - Shaanxi Longstar New Material Technology Co., Ltd.
    [Buying office]
    China (Mainland)
  • Syringe

    Jiangsu China (Mainland) CE amp; ISO Three 1ml-50ml PP Injection amp; Puncture Instrument PreHCP 21G-27G, 1/2amp;quot; to 1 1/2amp;quot; 

    Disposable syringes,three parts,sterile 1.Size:1ml to 50ml 2.Needle: 21G-27G 3.Pack:Blister, 100PCS/BOX 4.CE & ISO Disposable syringes,three parts,sterile1.Size:1ml to 50ml2.Needle: 21G-27G3.Pack:Blister, 100PCS/BOX4.CE & ISO

  • Supplier - Changzhou Premium Healthcare Products Co., Ltd.
    [Manufacturer, Agent]
    China (Mainland)
  • syringe

    dacon Syringe Shanghai or Qingdao 01 Shandong China (Mainland) L/C,T/T,Western Union Injection amp; Puncture Instrument 1ml,2ml,3ml,5ml,10ml,20ml,50ml 

    syringe : 1) Medical consumption; 2) Type:two part or three part; 3) Packing: PE or Blister packing; 4) Features:1ml,2ml,3ml syringeFeatures:1ml,2ml,3ml,5ml,10ml,20ml,50ml,60mlType:two part or three partPacking: PE or Blister packing

  • Supplier - Qingdao Dacon Trading Co., Ltd.
    China (Mainland)
  • syringe

    oem Injection Puncture Instrument SG syringe Jiangsu China (Mainland) 1000000 Piece/Pieces per Month T/T 

    syringe Luer slip or luer lock Capacity 1, 2.5, 5, 10, 20, 30, 50ml Packaging: 1pc/PE bag or 1pc/blister syringeLuer slip or luer lockCapacity 1, 2.5, 5, 10, 20, 30, 50mlPackaging: 1pc/PE bag or 1pc/blisterCertificate: CE, ISO9001

  • Supplier - Ningbo Qihao International Trade Co., Ltd.
    China (Mainland)

    Hypodermic syringes are used with hypodermic needles to inject liquid or gases into body tissues, or to remove from the body. Insulin syringes are marked in insulin "units". Syringes for insulin users are designed for standard U-100 insulin. The diluti

  • Supplier - Mercator Pharmaceutical Solutions
    [Manufacturer,Trading Company]
    China (Mainland)
  • Syringes

    SIR USD28-75 Busan, Korea 21G-30G Jeollanam-do South Korea L/C,D/A,D/P,T/T Injection Puncture Instrument 30,000,000 Piece/Pieces per Month 

    Product Description Our syringes are made of special, highly Harm-free translucent polypropylene for easy dosage measuremen Product FeatureDesigned for hand comfort- Bold, extra black scale markings resist smudging and are easy to read

  • Supplier - Bin Production Corp
    [Manufacturer, Trading Company]
    South Korea

    Injection Puncture Instrument 

    SYRINGE Translucent plastic barrel graduated in Cm³ Luer fitting; sealed in individual sterile packs. Not for paraldehyde.Without needle. Supplied in packs of ten.MODELCAPACITYA844141Cm³A844262Cm³A844385Cm³A8444910Cm³

    [Manufacturer,Trading Company]

    Last Minutes Additions - SYRINGES Extremely useful for measuring and transferring fluids and gas samples, made of glass, sealed in individual pack, prominent calibration marking, assures accurate measurement. Available in 1ml, 5ml, 10ml, 30ml

    [Manufacturer,Trading Company]
  • syringe

    Jiangsu China (Mainland) shanghai Medical Polymer Materials amp; Product... General Medical Supplies HER 10000000 Carton/Cartons per Month D/P,T/T,Western Union 

    Disposable syringe Got CE, ISO & FDA,TUV approval. Annual sales volume reach 2 billion sets. Disposable syringeLuer lock syringe(0.05-0.1ml,0.5ml,1ml,2ml,2.5ml,3ml,5-6ml,10-12ml,20ml,25ml,30ml,50ml,60ml)1. Sterilized by EO gas, non-toxic

  • Supplier - Changzhou Hua Er Rui International Trade Co., Ltd.
    China (Mainland)
You may also be interested in:syringe Moldfeeding syringesyringe plantsyringe stoppersautomatic syringeveterinary syringe
China Trypsin syringe:China Irrigation SyringeChina syringe highlighterChina medical syringesChina dispensing syringeChina feeding syringeChina syringe plant

Selected(1/4)Contact or Compare