Related Searches : Trypsin-Chymotrypsin MixMg PaperMg IngotEDTA-MgMg AlloyMg granulesMg Green
Need Help?Contact Us
Biopro Chemicals Co., Ltd.
roll forming machines
Wuxi Wondery Trading Co.,Ltd.
Common Rail Deisel
High purity Testosterone Enanthate Nandrolone Decanoate
taiguirawsteroid
shtangfang

  • Trypsin 2500u/mg

    Beijing China (Mainland) White Porcine or bovine pancreas Pig Any port of China Incubator ISO9001:2008; Reach by EU L/C,D/P,T/T 

    1.USP /EP standard Trypsin 2. Porcine or bovine pancreas 3.food&pharmaceutical grade trypsin 4.White crystallized powder Trypsin CAS 9002-07-7 Source Swine (Bovine) pancreasGeneral descriptionTrypsin is a kind of serine proteolytic enzyme

  • Supplier - Beijing Geyuantianrun Bio-Tech Co., Ltd.
    [Manufacturer ]
    China (Mainland)
    Credibility: 
      
  • Trypsin

    Shandong China (Mainland) china port 2500u/mg fraken Food Grade, Medicine Grade Trypsin L/C,T/T 1 Kilogram/Kilograms or as your need 

    Trypsin assay: 2500u/mg min standard:cp2005,EP5.0,usp28,BP2002 Trypsinassay: 2500u/mg minstandard:cp2005,EP5.0,usp28,BP2002application: cure part dropsy, haematoma, abscess and other diseases which caused by pus-chest, henothorax

  • Supplier - Qingdao Fraken International Trading Co., Ltd.
    [Other]
    China (Mainland)
    Credibility: 
  • Trypsin

    Shanghai China (Mainland) Shanghai 99% Trypsin high T/T,Western Union,MoneyGram Seebio 2 Metric Ton/Metric Tons per Year 

    Trypsin is a proteolytic enzyme Trypsin is a proteolytic enzyme, which specifically cleaves positively charged side chains with lysine and arginine. The optimum pH is 8.0. Trypsin is inhibited by natural inhibitors from pancreas

  • Supplier - Seebio Biotech Inc.
    [Manufacturers]
    Credibility: 
  • Trypsin

    CP,EP,BP,JP,USP 50T/Year largest producer of enzymes in china 

    Trypsin Resource: Porcine or bovine pancreas General introduction: Trypsin is a proteolytic enzyme. It can hydrolyze the positive charge side linking that containing lysine and arginine. The best effective condition is PH 8.0. It can be restrained

  • Supplier - Sichuan Deebio Pharmaceutical Co., Ltd.
    [Manufacturer]
    China (Mainland)
    Credibility: 
  • Trypsin

    Ukraine White Trypsin bottles Trypsin TOP QUALITY HACCP Cattle 

    We pioneered when it come to Agricultural Production(Animal Extract) in Ukraine. with our first reforms in the west territory of thepeninsular., Penang in 1974 and our first corrugation plant inproduction process in 1980. Today, we own one of the largesti

  • Supplier - Aplas Manhantan Investment Private Limited Company
    [Manufacturer,Trading Company]
    Ukraine
    Credibility: 
  • Trypsin (USP)

    Hebei China (Mainland) C6H15O12P3 china Trypsin (porcine pancreas) Medicine Grade 232-650-8 L/C,D/P,T/T,Western Union BDSC 

    1. Resource: Porcine or bovine panceas 2. Form:White or whitish crystal powder 2. High purity 3. Copetitive price Test ItemsSpecificationResultAppearancewhite powderConformsIdentificationConformsConformsTrypsin≤2500USP.U/mg3372USP

  • Supplier - Baoding Sino-Chem Industry Co., Ltd.
    [Manufacturer,Trading Company]
    China (Mainland)
    Credibility: 
      
  • recombinant trypsin

    Zhejiang China (Mainland) cell culture, Insulin Shanghai gt;95% by SDS-PAGE trypsin L/C,T/T INDUMY Catalyst 

    r-Trypsin expressed in E. Coli is purified by chromatography to homogeneity of high purity. Its molecular weight is 24 kda, Recombinan Trypsin ( r-Trypsin) expressed in E. Coli is purified by chromatography to homogeneity of high purity. Its mol

  • Supplier - Zhuji Wanshun Socks Co., Ltd.
    [Manufacturer ]
    China (Mainland)
    Credibility: 
  • Bovin Trypsin

    Bovin TrypsinSynonymCationic trypsinBovine pancreatic trypsinBeta-trypsinAlpha-trypsinSource: Highly purified bovin trypsin from bovin Pancreas.CAS Number: 9002-07-7UniProt ID: P00760EC: 3.4.21.4Sequence: IVGGYTCGANTVPYQVSLNSGYHFCGGSLINSQWVVSAAHCYKSGIQVRL

  • Supplier - HONGKONG PE BIOSCIENCES LIMITED
    [Manufacturers]
    China (Mainland)
    Credibility: 
  • Trypsin syringe

    Injection amp; Puncture Instrument 1ml Jiangsu China (Mainland) 

    Trypsin syringe,blister packaging,needle attached,100U,40U, march 29G, 30G needle Trypsin syringe,blister packaging,needle attached,100U,40U, march 29G, 30G needleDescription:1ml, blister packagingLength:0.62Width:0.36Height:0.33pcs/box:2000

  • Supplier - Yixing Kairun Imp & Exp Co., Ltd.
    [Manufacturer, Trading Company]
    China (Mainland)
    Credibility: 
  • Trypsin (Bovine Pancreas)

    Hebei China (Mainland) C6H15O12P3 Xingang, Qingdao N.L.T. 2,500 USP units / mg powder trypsinogen Medicine Grade L/C,T/T LD 

    Trypsin Source: Bovine Pancreas EC: 3.4.21.4 CAS:9002-07-7 TrypsinSource: Bovine PancreasEC: 3.4.21.4DescriptionTrypsin is a proteolytic enzyme, which specifically cleaves positively charged side chains with lysine and arginine

  • Supplier - Hebei Lead Bio-Chemicals Co., Ltd.
    China (Mainland)
    Credibility: 
      
  • Recombinant Trypsin Solution

    yaxinbio 

    Animal Origin Free Recombinant Trypsin Solution, Ready-to-Use Animal Origin Free, No Virus Contaminant DESCRIPTION Recombinant trypsin solution, is an animal-component free trypsin solution optimized for cell dissociation. It is formulated wit...

  • Supplier - Shanghai Yaxin Biotechnology Co., Ltd.
    [Manufacturer,]
    China (Mainland)
    Credibility: 
        
  • Trypsin-Chymotrypsin

    General Reagents Sichuan China (Mainland) 200 Ton/Tons per Year L/C,T/T 

    Trypsin-Chymotrypsin is a Proteolytic enzyme Trypsin-Chymotrypsin is a Proteolytic enzyme. It can liquefy pus and ruined organization depurate wounds; it also can accelerate the recovering of injuries. Specification:6:1 9:1

  • Supplier - Deyang Sinozyme Pharmaceutical Co., Ltd.
    China (Mainland)
    Credibility: 
  • trypsin

    China (Mainland) C6H15O12P3 232-650-8 98 T/T,Western Union JYL 600 Metric Ton/Metric Tons per Year High Purity Reagents 

    Trypsin is a Proteolytic enzyme. It can hydrolyze the positive charge side linking that containing lysin and arginine. General Introduction:Trypsin is a Proteolytic enzyme

  • Supplier - Shenyang Jin Yi Lai Chemical Co., Ltd.
    [Manufacturers]
    China (Mainland)
    Credibility: 
  • (IC)LG2500U LG2500

    Philippines sales@szmjd.com Shenzhen / HongKong T/T / Western Union  LG2500U LG2500 LG BGA 

    (IC)LG2500U LG2500 - LG 1.Sample Offer2.Competitive Price3.In stock Fastest Delivery4.First-rate Service&Quality Product Our company as a professional Electronic wholesaler for several years fast developing have already beening a famous tradi

  • Supplier - MINGJIADA (HK) INDUSTRIAL CO LTD
    [Manufacturer,Distributor/Wholesaler]
    China(Hongkong)
    Credibility: 
        
  • Trypsin CAS:9002-07-7

    Beijing, Tianjin bovine Trypsin Enzyme White 3000 Kilogram/Kilograms per Month L/C,T/T,Western Union 

    1.Product: Trypsin 2.Assay: 2500u/mg min 3.Standard:cp2005,EP5.0,usp28,BP2002 4.Source: Porcine (Bovine) pancreas Trypsin CAS:9002-07-71.Product: Trypsin2.Assay: 2500u/mg min3.Standard:cp2005,EP5.0,usp28,BP20024.Source

  • Supplier - Baoding Yunxin Trade Co., Ltd.
    [Manufacturer, Trading Company]
    China (Mainland)
    Credibility: 
  • Trypsin

    China (Mainland) C6H15O12P3 FOB TIANJIN/DALIAN 2500u/mg Trypsin L/C,T/T 1000 Metric Ton/Metric Tons per Month Pharmaceutical Intermediates 

    1. Standard:USP,BP,EP 2.Trypsin: NLT 2500USP units/mg powder 3.Source: Porcine (Bovine) pancreas 4.High purity in low pric Trypsin is a kind of serine proteolytic enzyme, with molecular weight of 23300 dalton

  • Supplier - SHENYANG XINXIN CHEMICAL INDUSTRY CO LTD
    [Manufacturer]
    China (Mainland)
    Credibility: 
  • Trypsin

    L/C,T/T CFR From Mar 26,2012 To Mar 26,2013 

    Wanbang BioPharmaceuticals has been established in 1981, is a leading anti-diabetic pharmaceutical company in China. We can manufacture the trypsin in the existing plant. Welcome to inquire.

  • Supplier - Wanbang Biopharmaceuticals
    [Manufacturer, Trading Company]
    China (Mainland)
    Credibility: 
  • Trypsin-Chymotrypsin 1:1 Mix

    TRYPSIN/ CHEMOTRYPSIN 1:1 MIX Trypsin-Chymotrypsin 1:1 TRYPSIN/ CHEMOTRYPSIN 1:1 MIXTrypsin-Chymotrypsin 1:1Source: Bovine PancreaseGeneral descriptionTrypsin-Chymotrypsin is the co-crystal of Chymotrypsin and Trypsin so it has the properties of

  • Supplier - Shanghai Element Technology Company Limited
    [Manufacturer, Trading Company ]
    China (Mainland)
    Credibility: 
  • Trypsin chymotrypsin Mix (6:1)

    INTRODUCTION : Trypsin chymotrypsin Mix (6:1) is a proteolytic enzyme obtained by controlled activation of zymogens form in the glands,followed by concentration and purification steps which give trypsinchymotry

  • Supplier - Aggreem International Pvt.Ltd.
    India
    Credibility: 
  • Mg

    Xingang Mg-99.9% Min Shanxi China (Mainland) 25000 Ton/Tons per Year L/C,D/P,T/T 

    Commodity: Magnesium Metal Specs: Mg - 99, 9% min. Shape: Special shape produced at customer's request Commodity: MagnesiumMetal Shape: Special shape produced at customer's requestSpecification: Mg 99.9% min. Fe 0.02% max. Si 0.03% max

  • Supplier - Shanxi Dajin International (Group) Co., Ltd.
    [Manufacturers]
    China (Mainland)
    Credibility: 
      
  • Trypsin-Chymotrypsin

    US $300 - 800 / Kilogram 5.0-7.0 Pharmaceuticals,food,etc Shanghai Trypsin-chymotrypsin 6:1 BIOLIFEZYME T83 White crytallized powder Anhui China (Mainland) 

    Trypsin-chymotrypsin , Find Complete Details about Trypsin-chymotrypsin,Trypsin-chymotrypsin from Supplier or Manufacturer-Hefei Esun Enterprise

  • Supplier - Hefei Esun Enterprise
    [Manufacturer, Trading Company]
    China (Mainland)
    Credibility: 
  • Trypsin

    SUNBOW China 

    Trypsin, Find Details about TRYPSIN, USP/EP from Trypsin - Sunbow Biotech Ltd.

  • Supplier - Sunbow Biotech Ltd.
    [Manufacturer, Trading Company]
    China (Mainland)
    Credibility: 
  • Trypsin inhibitor, a1-

    Appearance: off-white salt-free, lyophilized powder Assay: 99% Exterior: off-white Package: Aluminum bag Storage: 2-8°C Specifications ALPHA-1-ANTITRYPSIN Chemical Properties storage temp. 2-8°C form salt-free, lyophilized powder color

  • Supplier - ZHEJIANG HOLYPHARM BIOTECH CO.,LTD
    [Manufacturer]
    China (Mainland)
    Credibility: 
        
  • WP48S12/2500U

    HK OR SZ WP48S12/2500U Japan 100 Piece/Pieces per Day RFQ T/T,Western Union 

    WP48S12/2500U IGBT IPM POWER MOUDLE WP48S12/2500U IGBT IPM POWER MOUDLE

  • Supplier - HONGLIXIN TECHNOLOGY ELECTRON LTD
    [Trading Company, Distributor/Wholesaler]
    China (Mainland)
    Credibility: 
      
  • -X2500A; TLP-X2500U

    TOSHIBA 50*50 220V TLPLW1 / SHP93 Japan 2000H 200W UHP 

    Quick Details Place of Origin: China (Mainland) Brand Name: For Toshiba Model Number: TLPLW11 Base Type: Bulb with/ without housing Rated Power: 200W Life Expectancy: 2000 Hours Voltage: 200V Shipping Way: DHL; UPS; Fedex

  • Supplier - Guangzhou Zhunju Electronic Technology Co., Ltd.
    [Manufacturers]
    China (Mainland)
    Credibility: 
  • 2500U Universal Hose Cap

    No more thread problems! The U.F.S. universal pull cap protects all threads by gripping valve 2500U Universal Hose Cap No more thread problems! The U.F.S

  • Supplier - United Fire Safety Co., Ltd.
    [Trading Company]
    United States
    Credibility: 
  • Mg alloy

    Henan China (Mainland) ingot Tianjin/Qingdao/Shanghai GB Mg Ingots silver white L/C,T/T Mg-Al-Zn-Mn, Mg-Zn-Zr deformation ... 

    Mg alloy color: silver white Material: Mg Ingots Chemical Composition: Al Zn Mn Place of origin: Henan Mg alloyProduct: Mg-Al-Zn-Mn, Mg-Zn-Zr deformation Mg Alloy series and AZ, AM die-casting Mg Alloy series.Standard: ASTM,BC,DIN and JIS

  • Supplier - Henan Yindu Chemical Co., Ltd.
    [Manufacturer]
    China (Mainland)
    Credibility: 
  • Concerta 18mg 27mg 36mg 54mg 2

    We are glad to display our good quality HACCP certified drug for sale at a good market price and shipped in discrete and confidential branded packages. Products Guarantee All items are original brand named and certified products. All prod...

  • Supplier - Pharma Health Way Open Supply Sarl
    [Manufacturer,Trading Company]
    Cameroon
    Credibility: 
  • mg alloy

    Hunan China (Mainland) 4.5~5.0kg shanghai Is Alloy Mg alloy silvery material L/C,D/A,T/T yuhang 

    mg master alloy 1.Low segregation 2.For ZM serie alloy 3.good quality with cheap price mg master alloy for magnesiumtrademark alloy1. The shape and packaging of the products is according to user’s requirements. In general

  • Supplier - Yueyang Yuhang New Materials Co., Ltd.
    [Manufacturer]
    China (Mainland)
    Credibility: 
  • Mg powder

    Tianjin FM1,FM2,FM3,FM4,FM5 Shanxi China (Mainland) 3000 Metric Ton/Metric Tons per Year L/C,T/T,faxed B/L 

    The professional Mg powder exporter-YQMM. FM1,FM2,FM3,FM4,FM5,etc Also can supply Mg powder as per the customer's requirements We specialize in the export of Mg poder,Magnesium powder,the specification is as follows

  • Supplier - Shanxi Province Yangquan Metals & Minerals Imp. & Exp. Co., Ltd.
    [Manufacturers]
    China (Mainland)
    Credibility: 
  • MgO

    85%, 87%,90%, 92% Dalian Magnesium Oxide 1309-48-4 Hebei China (Mainland) 20000 Metric Ton/Metric Tons per Year L/C,T/T 

    MgO 80%,85%, 90%,92%,93%,95% Refractory grade,abbrasive grade,fertilizer grade,feed grade,construction grade,paper making gra MgOMolecular Formula: MgOMolecular Weight: 40.30White amorphous powder, odorless, smell-less and nontoxicUse

  • Supplier - Hebei Jinshi Dacheng Chemical Corp., Ltd.
    [Manufacturer, Trading Company ]
    China (Mainland)
    Credibility: 
      
  • Mg powder

    China (Mainland) Mg Powder 65% Magnesia L/C,T/T,Reconsideration HONGJI Quick 

    1,Product calcined uniform. 2,Quality and stability. 3,Widely used in papermaking, chemical industry. 4,High purity, high act Magnesia isburned by the light reflection kiln, rotary kiln or fluidized bed roaster calcine

  • Supplier - YINGKOU HONGJI DAYU TRADING CO., LTD.
    [Manufacturer, Trading Company]
    China (Mainland)
    Credibility: 
  • Mg Ingots

    China (Mainland) Tianjin,Shanghai Non-alloy Mg99.9% L/C,T/T 25 Metric Ton/Metric Tons Non-secondary ISO9001:2008 

    Mg: 99.9% min; Fe: 0.05% max; Si: 0.1% max; Ni: 0.02% max; Cu: 0.05% max; Al: 0.05% max; Mn: 0.1% max; Others each 0.05% max Mg Ingots:We can produce & supply Magnesium Ingots, Mg Ingots, Mg Metal used in steel & foundry industries

  • Supplier - Shaanxi Zenith I/E Co., Ltd.
    [Manufacturer, Trading Company]
    China (Mainland)
    Credibility: 
      
  • Pseudoephedrine hcl 30mg,60mg,90mg & 120mg

    We are one of the largest manufacturer & Exporter of Finished medicines & Bulk Drugs product in Pharmaceutical Sector in Gujarat since last 6 yrs. Our main market is U.S.A , CHINA, HONG KONG ,AFRICA, UK, MIDDLE EAST, SAUDI ARABIA & SRILANK

  • Supplier - infochemiczone.inc
    [Manufacturers]
    Cameroon
    Credibility: 
  • EDTA-Mg

    Carboxylic Acid China (Mainland) 

    EDTA-Mg micro nutrients which used in agriculture field and water soluble EDTA-Mg6 Formula:C10H12N2O8MgNA2; Molecular weight: 358.52; Appearance: white powder ; Magnesium chelated:6%min; water insoluble:0.1%max PH value(1% of the solution)

  • Supplier - Xiamen Vastland Chemical Co., Ltd.
    China (Mainland)
    Credibility: 
      
  • mg ingot

    CREDIT xingang port Non-alloy Non-secondary Shanxi China (Mainland) L/C,D/A,T/T 10 Metric Ton/Metric Tons 200g 

    Magnesium ingots: 200g packing: with plastic water proof covering and PE strap to tighten Magnesium ingots: Mg:99.9%min 200gpacking:in jumbo bags.detailed specification:Mg≥99.95%Fe≤0.003% Si≤0.01% Ni≤0.001% Cu≤0.002% Al≤0

  • Supplier - Shanxi Credit Magnesium Co., Ltd.
    [Manufacturer]
    China (Mainland)
    Credibility: 
1 2 3 4 5 6 7 8 9  ...  Next>>
You may also be interested in:mg anodeMg PlateMG PlusMG PosterMg rodMG stand
China Trypsin 2500u mg:China Mg IngotChina EDTA-MgChina Mg AlloyChina MG Tissue PaperChina Extruded Mg RodsChina MG cable gland

Selected(1/4)Contact or Compare